PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TCP
Protein Properties Length: 359aa    MW: 37633.3 Da    PI: 7.5633
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00904genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1202.8e-3767149385
         TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasns 85 
                 +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+ +i+++tg+++++as+  a++ + s+s++
  AA53G00904  67 PKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAESSIIAATGSGTIPASALAAAAAVGSVSHH 149
                 6999****************************************************************888666666666544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.2E-3071141IPR005333Transcription factor, TCP
PROSITE profilePS5136927.65972126IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MDPKNPNRHQ VPNFLNPPPP HRPQLMGDVD DDHKDDKSKS SEIKEFQITD KEGNSKKQQQ  60
QQNQLGPKRS SNKDRHTKVE GRGRRIRMPA LCAARIFQLT RELGHKSDGE TIQWLLQQAE  120
SSIIAATGSG TIPASALAAA AAVGSVSHHP GGSLTAGLMI SHDLDGGGGS GSSSGRPNWP  180
MVGIGGGGDG GGGSRSHNHQ IPSGLWPNVA GFGFQAPSSG GVVSTTGLMN EGGYRIGFPG  240
FDFPGVSNIG AMSFASILGT SGNNQLPGLE LGLSQEGNVG VLNPQSFTQI YQQMGQAQAQ  300
AQAQAQAQAQ AQAQAQAQAQ AQAQAQAQAQ ARVLHHSHHN PHEEQQESGE KDNSQGSGR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00005PBMTransfer from 484486Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266492e-75AB026649.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MOJ10.
GenBankAJ2917492e-75AJ291749.1 Arabidopsis thaliana mRNA for putative transcription factor (PCF1 gene).
GenBankAK1181782e-75AK118178.1 Arabidopsis thaliana At3g27010 mRNA for unknown protein, complete cds, clone: RAFL19-49-P20.
GenBankBT0060432e-75BT006043.1 Arabidopsis thaliana clone U50934 unknown protein (At3g27010) mRNA, complete cds.
GenBankCP0026862e-75CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006290367.11e-133hypothetical protein CARUB_v10017630mg
SwissprotQ9LSD51e-126TCP20_ARATH; Transcription factor TCP20
TrEMBLR0HDZ91e-133R0HDZ9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__478__AT3G27010.11e-131(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40502759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-99TCP family protein